Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter arcticus ATP synthase subunit a (atpB)

This Recombinant Psychrobacter arcticus ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q4FQ31

Expression Region

1-288

Origin

Psychrobacter arcticus (strain DSM 17307 / 273-4)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGEQTTTEYISHHLTNWTYGYLPGEGWKVAYTAEEASAMGFKAIHLDSMLWSIGLGIVF CAIFWMVARKVTSGVPGKLQAAVEMIIEFVDNNVRDSYSGTSKLIAPLALTIFVWIFLMN LMDLLPVDFVPGLAGQIGAMMGHDPHHVFFKIVPTTDPNITLGMSFSVFILILFYSIKEK GLGGFVGELTLHPFSAKNPIVQIILIPINFILEFVTLIAKPISLGLRLFGNMYAGELIFI LIALMPFWIQWALSVPWAIFHILIITLQAFVFMMLTIVYMSLASSTEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Meis1 Mouse Gene Knockout Kit (CRISPR)
KN309965LP 1 Kit

Meis1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-AcetyIglucosamine BSA Colloidal Gold Conjugate, 1mL 5nm
CCG-0005-5 1 mL

N-AcetyIglucosamine BSA Colloidal Gold Conjugate, 1mL 5nm

Sign In for Pricing
View Details
Calcitonin Impurity D TFA Salt
TRC-C144559-5MG 5 mg

Calcitonin Impurity D TFA Salt

Sign In for Pricing
View Details
Recombinant Human SSPINK7/ECG2 Protein (His Tag)
PKSH033047-01 10 µg

Recombinant Human SSPINK7/ECG2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SSPINK7/ECG2 Protein (His Tag)
PKSH033047-02 50 µg

Recombinant Human SSPINK7/ECG2 Protein (His Tag)

Sign In for Pricing
View Details
IL3RB (CSF2RB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B10]
TA807872BM 100 µL

IL3RB (CSF2RB) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B10]

Sign In for Pricing
View Details