Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep 3-hydroxyacyl-CoA dehydratase 1 (PTPLA)

This Recombinant Sheep 3-hydroxyacyl-CoA dehydratase 1 (PTPLA) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 1, HACD1, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member A

UniProt

Q9N1R5

Expression Region

1-288

Origin

Ovis aries (Sheep)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRLTEAAAAGGGASAARSAGPPPAPLPLSSTSPGCAAAMASSEEDGTNGGASEASDERE AVGKRRRLGLLATIWLTFYNIAMTAGWLVLAIAMVRFYMEKGTHKGLYKSIQKTLKFFQT FALLEIVHCLIGIVPTSVLVAGVQVSSRIFMVWLVTHSIKPIQNEESVVLFLVAWTVTEI TRYSFYTFSLLDHLPYFIKWARYNFFIILYPVGVAGELLTIYAALPYVKKTGMFSIRLPN KYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIVEKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ICOS Antibody (669222) [HRP]
FAB6975H 0.1 mL

Mouse Monoclonal ICOS Antibody (669222) [HRP]

Sign In for Pricing
View Details
ZNF296 (C-12) : m-IgG1 BP-HRP Bundle
sc-533326 1 Kit

ZNF296 (C-12) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Mnk1 (phospho Thr250) Polyclonal Antibody
MBS8585911-01 0.1 mg

Mnk1 (phospho Thr250) Polyclonal Antibody

Sign In for Pricing
View Details
Mnk1 (phospho Thr250) Polyclonal Antibody
MBS8585911-02 0.1 mL (AF405L)

Mnk1 (phospho Thr250) Polyclonal Antibody

Sign In for Pricing
View Details
Mnk1 (phospho Thr250) Polyclonal Antibody
MBS8585911-03 0.1 mL (AF405S)

Mnk1 (phospho Thr250) Polyclonal Antibody

Sign In for Pricing
View Details
Mnk1 (phospho Thr250) Polyclonal Antibody
MBS8585911-04 0.1 mL (AF610)

Mnk1 (phospho Thr250) Polyclonal Antibody

Sign In for Pricing
View Details