Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sheep 3-hydroxyacyl-CoA dehydratase 1 (PTPLA)

This Recombinant Sheep 3-hydroxyacyl-CoA dehydratase 1 (PTPLA) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

3-hydroxyacyl-CoA dehydratase 1, HACD1, EC= 4.2.1.-, Protein-tyrosine phosphatase-like member A

UniProt

Q9N1R5

Expression Region

1-288

Origin

Ovis aries (Sheep)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRLTEAAAAGGGASAARSAGPPPAPLPLSSTSPGCAAAMASSEEDGTNGGASEASDERE AVGKRRRLGLLATIWLTFYNIAMTAGWLVLAIAMVRFYMEKGTHKGLYKSIQKTLKFFQT FALLEIVHCLIGIVPTSVLVAGVQVSSRIFMVWLVTHSIKPIQNEESVVLFLVAWTVTEI TRYSFYTFSLLDHLPYFIKWARYNFFIILYPVGVAGELLTIYAALPYVKKTGMFSIRLPN KYNVSFDYYYFLLITMASYIPLFPQLYFHMLRQRRKVLHGEVIVEKDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CREB (Ser133) Antibody
AF3189-01 100 µL

Phospho-CREB (Ser133) Antibody

Sign In for Pricing
View Details
Phospho-CREB (Ser133) Antibody
AF3189-02 200 µL

Phospho-CREB (Ser133) Antibody

Sign In for Pricing
View Details
Recombinant Glycine max Repetitive proline-rich cell wall protein 2 (PRP2)
MBS1080395-01 0.02 mg (E-Coli)

Recombinant Glycine max Repetitive proline-rich cell wall protein 2 (PRP2)

Sign In for Pricing
View Details
Recombinant Glycine max Repetitive proline-rich cell wall protein 2 (PRP2)
MBS1080395-02 0.1 mg (E-Coli)

Recombinant Glycine max Repetitive proline-rich cell wall protein 2 (PRP2)

Sign In for Pricing
View Details
Recombinant Glycine max Repetitive proline-rich cell wall protein 2 (PRP2)
MBS1080395-03 0.02 mg (Yeast)

Recombinant Glycine max Repetitive proline-rich cell wall protein 2 (PRP2)

Sign In for Pricing
View Details
Recombinant Glycine max Repetitive proline-rich cell wall protein 2 (PRP2)
MBS1080395-04 0.1 mg (Yeast)

Recombinant Glycine max Repetitive proline-rich cell wall protein 2 (PRP2)

Sign In for Pricing
View Details