Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Mitochondrial brown fat uncoupling protein 1 (UCP1)

This Recombinant Bovine Mitochondrial brown fat uncoupling protein 1 (UCP1) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Mitochondrial brown fat uncoupling protein 1, UCP 1, Solute carrier family 25 member 7, Thermogenin

UniProt

P10861

Expression Region

1-288

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IFSAGVAACVADIITFPLDTAKVRLQIQGECLISSAIRYKGVLGTIITLAKTEGPVKLYS GLPAGLQRQISLASLRIGLYDTVQEFFTTGKEASLGSKISAGLMTGGVAVFIGQPTEVVK VRLQAQSHLHGPKPRYTGTYNAYRIIATTEGLTGLWKGTSPNLTTNVIINCTELVTYDLM KEALVKNKLLADDVPCHFVSAVVAGFCTTVLSSPVDVVKTRFVNSSPGQNTSVPNCAMMM LTREGPSAFFKGFVPSFLRLGSWNIMFVCFERLKQELMKCRHTMDCAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
BNC400276-100 1x 100 µL

TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL
BNC040253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL
BNC682848-100 1x 100 µL

Fibronectin (Fn-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF740 conjugate, 0.1mg/mL
BNC740324-500 1x 500 µL

CD53 (161-2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117), CF594 conjugate, 0.1mg/mL
BNC940476-100 1x 100 µL

CD79a (JCB117), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA414 + CGA/777 + CGA/798), CF647 conjugate, 0.1mg/mL
BNC471060-500 1x 500 µL

Chromogranin A (CGA414 + CGA/777 + CGA/798), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details