Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphohydrolase 2 (PPAP2C)

This Recombinant Human Lipid phosphate phosphohydrolase 2 (PPAP2C) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 2, EC= 3.1.3.4, PAP2-gamma, PAP2-G, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, PAP-2c, Short n

UniProt

O43688

Expression Region

1-288

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV TITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLA LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTV CYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC1 Rabbit Polyclonal Antibody (APC)
orb2613595 100 µg

XRCC1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
anti-Ribonuclease Inhibitor
YF-PA14407 100 ul

anti-Ribonuclease Inhibitor

Sign In for Pricing
View Details
Rabbit Anti Human ADRA1B Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 120UL
IRBAMLADRA1BAP54120UL 120 µL

Rabbit Anti Human ADRA1B Polyclonal Affinity Purified (PBS with 0.05% sodium azide and 50% glycerol, pH7.4) (Western Blot,ELISA) 120UL

Sign In for Pricing
View Details
SLC6A20 Antibody - C-terminal region
MBS3221928-01 0.1 mL

SLC6A20 Antibody - C-terminal region

Sign In for Pricing
View Details
SLC6A20 Antibody - C-terminal region
MBS3221928-02 5x 0.1 mL

SLC6A20 Antibody - C-terminal region

Sign In for Pricing
View Details
Recombinant Human Interleukin-12 p35, His Tag
MBS142363-01 0.002 mg

Recombinant Human Interleukin-12 p35, His Tag

Sign In for Pricing
View Details