Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphohydrolase 2 (PPAP2C)

This Recombinant Human Lipid phosphate phosphohydrolase 2 (PPAP2C) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 2, EC= 3.1.3.4, PAP2-gamma, PAP2-G, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, PAP-2c, Short n

UniProt

O43688

Expression Region

1-288

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV TITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLA LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTV CYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr609-set siRNA/shRNA/RNAi Lentivector (Mouse)
33298094 4x 500 ng

Olfr609-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
TMEM140 cDNA Clone
MBS1268093-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TMEM140 cDNA Clone

Sign In for Pricing
View Details
TMEM140 cDNA Clone
MBS1268093-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TMEM140 cDNA Clone

Sign In for Pricing
View Details
Ly49i2 3'UTR GFP Stable Cell Line
TU262669 1.0 mL

Ly49i2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Krtap15 ORF Vector (Mouse) (pORF)
ORF048860 1.0 µg DNA

Krtap15 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
PSMC2 Antibody
32536-01 50 µL

PSMC2 Antibody

Sign In for Pricing
View Details