Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lipid phosphate phosphohydrolase 2 (PPAP2C)

This Recombinant Human Lipid phosphate phosphohydrolase 2 (PPAP2C) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

Lipid phosphate phosphohydrolase 2, EC= 3.1.3.4, PAP2-gamma, PAP2-G, Phosphatidate phosphohydrolase type 2c, Phosphatidic acid phosphatase 2c, PAP-2c, Short n

UniProt

O43688

Expression Region

1-288

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQRRWVFVLLDVLCLLVASLPFAILTLVNAPYKRGFYCGDDSIRYPYRPDTITHGLMAGV TITATVILVSAGEAYLVYTDRLYSRSDFNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMI GRLRPNFLAVCDPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLA LYVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAALTV CYISDFFKARPPQHCLKEEELERKPSLSLTLTLGEADHNHYGYPHSSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Actin Antibody (ACTA1/360)
NBP3-13759-100ug 100 µg

Mouse Monoclonal Actin Antibody (ACTA1/360)

Sign In for Pricing
View Details
Lentiviral mouse Rin2 shRNA (UAS) - Lentiviral mouse Rin2 shRNA (UAS, RFP) (25)
GTR15212051 1 Vial

Lentiviral mouse Rin2 shRNA (UAS) - Lentiviral mouse Rin2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
AGPAT2 Knockout A2780 Polyclonal Cells
ARG28627 1 Million

AGPAT2 Knockout A2780 Polyclonal Cells

Sign In for Pricing
View Details
ZC4H2 sgRNA CRISPR Lentivector (Human) (Target 1)
K2666002 1.0 µg DNA

ZC4H2 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
CD18 (Beta 2 Antigen CD18 (p95), Cell Surface Adhesion Glycoproteins LFA 1/CR3/p150 95 beta Subunit, Complement Receptor C3 beta Subunit, Integrin beta 2, ITGB2, LAD, LCAMB, Leukocyte Cell Adhesion Molecule CD18, LFA1, Lymphocyte Function Associated Antigen 1, Macrophage Antigen 1 (mac1) beta Subunit, MF17) (APC)
C2269-02K-APC 100 µL

CD18 (Beta 2 Antigen CD18 (p95), Cell Surface Adhesion Glycoproteins LFA 1/CR3/p150 95 beta Subunit, Complement Receptor C3 beta Subunit, Integrin beta 2, ITGB2, LAD, LCAMB, Leukocyte Cell Adhesion Molecule CD18, LFA1, Lymphocyte Function Associated Antigen 1, Macrophage Antigen 1 (mac1) beta Subunit, MF17) (APC)

Sign In for Pricing
View Details
EBF1 Recombinant Antibody, PerCP-Cy5.5 Conjugated
bsm-62038R-PerCP-Cy5.5 100 µL

EBF1 Recombinant Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details