Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter sp. ATP synthase subunit a (atpB)

This Recombinant Psychrobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5WBV5

Expression Region

1-288

Origin

Psychrobacter sp. (strain PRwf-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEITSTDYIAHHLTNWTYGYLPGEGWKVAHTAKEAGEMGFMAIHLDSMLWSIGLGIVF CALFWLVAKKATAGVPGKLQAAIEMIVEFVDTNVRDSYNGTSKLIAPLALTIFVWIFLMN LMDLMPIDYIPVLAQKVGAAMGHDPHHVFFKIVPTTDPNITLGMSFSVFALIIYYSIKEK GLGGFVGELTLHPFSAKNPIAKIILIPINFILEFVTLIAKPISLGLRLFGNMYAGELIFV LIALMPFWIQWALSVPWAIFHILIITLQAFVFMMLTIVYLSLASQTEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL24 ELISA Kit (Mouse)
OKEH04091-96W 96 Well

IL24 ELISA Kit (Mouse)

Sign In for Pricing
View Details
Ribonuclease A (RNase A) Polyclonal Antibody
CAU37482-01 100 µL

Ribonuclease A (RNase A) Polyclonal Antibody

Sign In for Pricing
View Details
Ribonuclease A (RNase A) Polyclonal Antibody
CAU37482-02 200 µL

Ribonuclease A (RNase A) Polyclonal Antibody

Sign In for Pricing
View Details
Ribonuclease A (RNase A) Polyclonal Antibody
CAU37482-03 1 mL

Ribonuclease A (RNase A) Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal Antibody to Neuropeptide S (NPS)
TRV-0034679-01 20 µL

Monoclonal Antibody to Neuropeptide S (NPS)

Sign In for Pricing
View Details
Monoclonal Antibody to Neuropeptide S (NPS)
TRV-0034679-02 100 µL

Monoclonal Antibody to Neuropeptide S (NPS)

Sign In for Pricing
View Details