Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter sp. ATP synthase subunit a (atpB)

This Recombinant Psychrobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5WBV5

Expression Region

1-288

Origin

Psychrobacter sp. (strain PRwf-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEITSTDYIAHHLTNWTYGYLPGEGWKVAHTAKEAGEMGFMAIHLDSMLWSIGLGIVF CALFWLVAKKATAGVPGKLQAAIEMIVEFVDTNVRDSYNGTSKLIAPLALTIFVWIFLMN LMDLMPIDYIPVLAQKVGAAMGHDPHHVFFKIVPTTDPNITLGMSFSVFALIIYYSIKEK GLGGFVGELTLHPFSAKNPIAKIILIPINFILEFVTLIAKPISLGLRLFGNMYAGELIFV LIALMPFWIQWALSVPWAIFHILIITLQAFVFMMLTIVYLSLASQTEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Resistin (RETN) ELISA Kit
MBS2020226-01 24 Strip Well

Rat Resistin (RETN) ELISA Kit

Sign In for Pricing
View Details
Rat Resistin (RETN) ELISA Kit
MBS2020226-02 48 Well

Rat Resistin (RETN) ELISA Kit

Sign In for Pricing
View Details
Rat Resistin (RETN) ELISA Kit
MBS2020226-03 96 Well

Rat Resistin (RETN) ELISA Kit

Sign In for Pricing
View Details
Rat Resistin (RETN) ELISA Kit
MBS2020226-04 5x 96 Well

Rat Resistin (RETN) ELISA Kit

Sign In for Pricing
View Details
Rat Resistin (RETN) ELISA Kit
MBS2020226-05 10x 96 Well

Rat Resistin (RETN) ELISA Kit

Sign In for Pricing
View Details
Gm13889 Mouse Gene Knockout Kit (CRISPR)
KN506679 1 Kit

Gm13889 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details