Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychrobacter sp. ATP synthase subunit a (atpB)

This Recombinant Psychrobacter sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-288.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5WBV5

Expression Region

1-288

Origin

Psychrobacter sp. (strain PRwf-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEITSTDYIAHHLTNWTYGYLPGEGWKVAHTAKEAGEMGFMAIHLDSMLWSIGLGIVF CALFWLVAKKATAGVPGKLQAAIEMIVEFVDTNVRDSYNGTSKLIAPLALTIFVWIFLMN LMDLMPIDYIPVLAQKVGAAMGHDPHHVFFKIVPTTDPNITLGMSFSVFALIIYYSIKEK GLGGFVGELTLHPFSAKNPIAKIILIPINFILEFVTLIAKPISLGLRLFGNMYAGELIFV LIALMPFWIQWALSVPWAIFHILIITLQAFVFMMLTIVYLSLASQTEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gm5820 activation kit by CRISPRa
GA217774 1 Kit

Mouse Gm5820 activation kit by CRISPRa

Sign In for Pricing
View Details
2500003M10Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4546504 1.0 µg DNA

2500003M10Rik sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal NM23-H1 Antibody
NBP3-03013-20ul 20 µL

Rabbit Polyclonal NM23-H1 Antibody

Sign In for Pricing
View Details
Loperamide Hydrochloride (mu-Opioid Receptor Agonist, Loperamide Hydrochloride, Imodium)
217515 1 g

Loperamide Hydrochloride (mu-Opioid Receptor Agonist, Loperamide Hydrochloride, Imodium)

Sign In for Pricing
View Details
Kv1.3 Polyclonal Antibody
E44H02569 100 µL

Kv1.3 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Papio anubis Suppressor of tumorigenicity 7 protein (ST7)
MBS7030559-01 0.02 mg

Recombinant Papio anubis Suppressor of tumorigenicity 7 protein (ST7)

Sign In for Pricing
View Details