Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)

This Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3K435

Expression Region

1-289

Origin

Pseudomonas fluorescens (strain Pf0-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAETTASGYIQHHLQNLTFGQLPNGGWGFAHTAAEAKEMGFWAFHVDTLGWSVALGLIFV LLFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLVPVDWVPQLAILISGDHHIPFRAVSTTDPNATLGMAFSVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQALLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF405S conjugate, 0.1mg/mL
BNC042570-500 1x 500 µL

YBX1 / Y-box Binding Protein 1 / YB-1 (Tumor Biomarker) (rYBX1/2430), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MFSD2A Human Gene Knockout Kit (CRISPR)
KN204264LP 1 Kit

MFSD2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ankrd16 Mouse Gene Knockout Kit (CRISPR)
KN501270 1 Kit

Ankrd16 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Gibberellin A6
TRC-G377320-1MG 1 mg

Gibberellin A6

Sign In for Pricing
View Details
Recombinant Retinoic Acid Receptor alpha Antibody
RC-15454-01 50 μL

Recombinant Retinoic Acid Receptor alpha Antibody

Sign In for Pricing
View Details
Recombinant Retinoic Acid Receptor alpha Antibody
RC-15454-02 100 µL

Recombinant Retinoic Acid Receptor alpha Antibody

Sign In for Pricing
View Details