Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)

This Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q3K435

Expression Region

1-289

Origin

Pseudomonas fluorescens (strain Pf0-1)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAETTASGYIQHHLQNLTFGQLPNGGWGFAHTAAEAKEMGFWAFHVDTLGWSVALGLIFV LLFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLVPVDWVPQLAILISGDHHIPFRAVSTTDPNATLGMAFSVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQALLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS707448 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD38 Antibody[NIMR5]
E-AB-F1193H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD38 Antibody[NIMR5]

Sign In for Pricing
View Details
MDC1 Human Gene Knockout Kit (CRISPR)
KN418728 1 Kit

MDC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRADC1 Human Gene Knockout Kit (CRISPR)
KN402972 1 Kit

PRADC1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details