Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU)

This Recombinant Salmonella paratyphi A Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Putative 2-aminoethylphosphonate transport system permease protein phnU

UniProt

Q5PFQ6

Expression Region

1-289

Origin

Salmonella paratyphi A (strain ATCC 9150 / SARB42)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLILPLEKPALNLRPLLWLLLPLLVLATLFFWPLSLIVEQALRGANGEIGLETFRQVVD SKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLIT LAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQI DKSQLEAASILGAHPLRVIGQVIFPAALPALMAGGSLCLLLTTNEFGIVLFIGAKGVNTL PMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASRTGVRSQPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LIF(Leukemia Inhibitory Factor) ELISA Kit
SYP-H0058-01 48 Well

Human LIF(Leukemia Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
Human LIF(Leukemia Inhibitory Factor) ELISA Kit
SYP-H0058-02 96 Well

Human LIF(Leukemia Inhibitory Factor) ELISA Kit

Sign In for Pricing
View Details
RAB22A ORF Vector (Human) (pORF)
38310011 1.0 µg DNA

RAB22A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Efaroxan
HY-B1416 1 Each

Efaroxan

Sign In for Pricing
View Details
FHL1 Lentiviral Activation Particles (m)
sc-420350-LAC 200 µL

FHL1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
F07F6.2 Antibody
orb803306 2 mg

F07F6.2 Antibody

Sign In for Pricing
View Details