Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas syringae pv. tomato ATP synthase subunit a (atpB)

This Recombinant Pseudomonas syringae pv. tomato ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q87TS8

Expression Region

1-289

Origin

Pseudomonas syringae pv. tomato (strain DC3000)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAEQTASGYIQHHLQNLTFGHLPNGDWGFAHTAAEAKEMGFWAFHVDTLGWSVALGLIFV LIFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSAVIAPLALTIFVWVFLMNA VDLVPVDWIPQLAMMISGDEHIPFRAVPTTDPNATLGMALSVFALIIFYSIKVKGIGGFI GELTLHPFGSKNIFVQALLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGIVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL
BNC681050-500 1x 500 µL

CD3e (CRIS-7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL
BNC041073-500 1x 500 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
BNC880679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nuclear Membrane (AE-5), CF647 conjugate, 0.1mg/mL
BNC470867-500 1x 500 µL

Nuclear Membrane (AE-5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF594 conjugate, 0.1mg/mL
BNC942561-500 1x 500 µL

NKX6.1 (Marker for Pancreatic and Duodenal Neuroendocrine Tumors) (NKX61/2561), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF568 conjugate, 0.1mg/mL
BNC682341-100 1x 100 µL

EGFR (Epidermal Growth Factor Receptor) (GFR/2341), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details