Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit a (atpB)

This Recombinant Pseudomonas putida ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q88BW8

Expression Region

1-289

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFL LIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLIPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPK gamma 1 (PRKAG1) (NM_001206709) Human Tagged ORF Clone
RC232528 10 µg

AMPK gamma 1 (PRKAG1) (NM_001206709) Human Tagged ORF Clone

Sign In for Pricing
View Details
Anti-Sortilin Rabbit Monoclonal Antibody
MA5208-.05 50 µL

Anti-Sortilin Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
SRI Antibody
22-460 100 µL

SRI Antibody

Sign In for Pricing
View Details
MER/SKY (Phospho-Tyr749/681) Polyclonal Conjugated Antibody
C11740 100 µL

MER/SKY (Phospho-Tyr749/681) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
4931406B18Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3188505 3x 1.0 µg

4931406B18Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Lifitegrast Impurity 57
RM-L090657-01 10 mg

Lifitegrast Impurity 57

Sign In for Pricing
View Details