What sizes are available for Recombinant Pseudomonas putida ATP synthase subunit a (atpB)?

Recombinant Pseudomonas putida ATP synthase subunit a (atpB) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Pseudomonas putida ATP synthase subunit a (atpB) come in?

Recombinant Pseudomonas putida ATP synthase subunit a (atpB) is available in 2 different pack sizes.

Recombinant Pseudomonas putida ATP synthase subunit a (atpB)

Q: What is the catalog number for Recombinant Pseudomonas putida ATP synthase subunit a (atpB)?

The catalog number for Recombinant Pseudomonas putida ATP synthase subunit a (atpB) is orb2910813.

This Recombinant Pseudomonas putida ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q88BW8

Expression Region

1-289

Origin

Pseudomonas putida (strain KT2440)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFL LIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLIPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH