Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU)

This Recombinant Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Putative 2-aminoethylphosphonate transport system permease protein phnU

UniProt

Q8Z8W9

Expression Region

1-289

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLILPLEKPALNLRPLLWLLLPLLALATLFFWPLSLIVEQALRGANGEIGLETFRQVVD SKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLIT LAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQI DKSQLEAASILGAHPLRVIGQVIFPAALPALMASGSLCLLLTTNEFGIVLFIGAKGVNTL PMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASRTGVRSQPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAD2L1 binding protein (MAD2L1BP) Human Gene Knockout Kit (CRISPR)
KN402640 1 Kit

MAD2L1 binding protein (MAD2L1BP) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethenesulfonyl chloride
TRC-E677750-500MG 500 mg

Ethenesulfonyl chloride

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793J-01 25 µg

PerCP/Cyanine5.5 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793J-02 100 µg

PerCP/Cyanine5.5 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Equine Defensin Beta 2 (DEFb2) ELISA Kit
RD-DEFb2-Eq-01 96 Tests

Equine Defensin Beta 2 (DEFb2) ELISA Kit

Sign In for Pricing
View Details
Equine Defensin Beta 2 (DEFb2) ELISA Kit
RD-DEFb2-Eq-02 48 Tests

Equine Defensin Beta 2 (DEFb2) ELISA Kit

Sign In for Pricing
View Details