Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU)

This Recombinant Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Putative 2-aminoethylphosphonate transport system permease protein phnU

UniProt

Q8Z8W9

Expression Region

1-289

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLILPLEKPALNLRPLLWLLLPLLALATLFFWPLSLIVEQALRGANGEIGLETFRQVVD SKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLIT LAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQI DKSQLEAASILGAHPLRVIGQVIFPAALPALMASGSLCLLLTTNEFGIVLFIGAKGVNTL PMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASRTGVRSQPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ɑ-Hydroxy-ω-Squaric Acid Ester Amido PEG
1320000-00-50.1G 1 g

Ɑ-Hydroxy-ω-Squaric Acid Ester Amido PEG

Sign In for Pricing
View Details
SAR1 (SAR1A) (NM_020150) Human Over-expression Lysate
LC402753 20 µg

SAR1 (SAR1A) (NM_020150) Human Over-expression Lysate

Sign In for Pricing
View Details
Smim8 Mouse Gene Knockout Kit (CRISPR)
KN516331 1 Kit

Smim8 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein / NP Protein (His Tag)
PKSV030159 100 µg

Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Nucleoprotein / NP Protein (His Tag)

Sign In for Pricing
View Details
Histone Demethylase (HDM) Fluorescent Activity Kit
K010-F1 2 Plates

Histone Demethylase (HDM) Fluorescent Activity Kit

Sign In for Pricing
View Details
INCA1 (NM_213726) Human Over-expression Lysate
LC403740 20 µg

INCA1 (NM_213726) Human Over-expression Lysate

Sign In for Pricing
View Details