Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU)

This Recombinant Putative 2-aminoethylphosphonate transport system permease protein phnU (phnU) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Putative 2-aminoethylphosphonate transport system permease protein phnU

UniProt

Q8Z8W9

Expression Region

1-289

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLILPLEKPALNLRPLLWLLLPLLALATLFFWPLSLIVEQALRGANGEIGLETFRQVVD SKRFVGALLNTLQIAFFATAGCLLLGSVMSLILVFIPFPGSELIGRVVDTFIALPTFLIT LAFTFIYGSAGLLNGALMSLFAFELPPVDFLYSMQGVILAEITVFTPLVMRPLMAALRQI DKSQLEAASILGAHPLRVIGQVIFPAALPALMASGSLCLLLTTNEFGIVLFIGAKGVNTL PMMVYSKAILESDYTVACMIALINIVLSLGLFSLYRLAASRTGVRSQPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Galactaric Acid
TRC-G155005-50G 50 g

Galactaric Acid

Sign In for Pricing
View Details
CHI3L1 Antibody
KC-2527-01 50 μL

CHI3L1 Antibody

Sign In for Pricing
View Details
CHI3L1 Antibody
KC-2527-02 100 µL

CHI3L1 Antibody

Sign In for Pricing
View Details
CHI3L1 Antibody
KC-2527-03 1 mL

CHI3L1 Antibody

Sign In for Pricing
View Details
Lewis A (7LE), CF568 conjugate, 0.1mg/mL
BNC680311-500 1x 500 µL

Lewis A (7LE), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF647 conjugate, 0.1mg/mL
BNC470484-100 1x 100 µL

Progesterone Receptor (PR484), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details