Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Melatonin receptor type 1B

This Recombinant Chicken Melatonin receptor type 1B spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

Melatonin receptor type 1B, Mel-1B-R, Mel1b receptor

UniProt

P51050

Expression Region

1-289

Origin

Gallus gallus (Chicken)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GNAFVVSLALADLVVALYPYPLVLLAIFHNGWTLGEMHCKVSGFVMGLSVIGSIFNITAI AINRYCYICHSFAYDKVYSCWNTMLYVSLIWVLTVIATVPNFFVGSLKYDPRIYSCTFVQ TASSYYTIAVVVIHFIVPITVVSFCYLRIWVLVLQVRRRVKSETKPRLKPSDFRNFLTMF VVFVIFAFCWAPLNFIGLAVAINPSEMAPKVPEWLFIISYFMAYFNSCLNAIIYGLLNQN FRNEYKRILMSLWMPRLFFQDTSKGGTDGQKSKPSPALNNNDQMKTDTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Prostate
CS804133 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CF®640R Hydrazide
#92157 1x 1 mg

CF®640R Hydrazide

Sign In for Pricing
View Details
Anti-KLF4 Mouse Monoclonal
Y030042 100 µL

Anti-KLF4 Mouse Monoclonal

Sign In for Pricing
View Details
Human NSDHL activation kit by CRISPRa
GA109455 1 Kit

Human NSDHL activation kit by CRISPRa

Sign In for Pricing
View Details
Rat Thymus Activation Regulated Chemokine (TARC) ELISA Kit
RDR-TARC-Ra-01 96 Tests

Rat Thymus Activation Regulated Chemokine (TARC) ELISA Kit

Sign In for Pricing
View Details
Rat Thymus Activation Regulated Chemokine (TARC) ELISA Kit
RDR-TARC-Ra-02 48 Tests

Rat Thymus Activation Regulated Chemokine (TARC) ELISA Kit

Sign In for Pricing
View Details