Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit a (atpB)

This Recombinant Pseudomonas putida ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5WBA9

Expression Region

1-289

Origin

Pseudomonas putida (strain F1 / ATCC 700007)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFL LIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLVPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GST Recombinant Rabbit monoclonal Antibody
HA750257 100 µL

GST Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Urah (NM_029821) Mouse Tagged ORF Clone
MG200535 10 µg

Urah (NM_029821) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tryptophol-d4
TRC-T894702-50MG 50 mg

Tryptophol-d4

Sign In for Pricing
View Details
ZNF217 Human Gene Knockout Kit (CRISPR)
KN424371 1 Kit

ZNF217 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NCF2 Rabbit Polyclonal Antibody
TA361348 100 µL

NCF2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), 0.2mg/mL
BNUB1283-500 1x 500 µL

VEGI (Vascular Endothelial Growth Inhibitor) (VEGI/1283), 0.2mg/mL

Sign In for Pricing
View Details