Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit a (atpB)

This Recombinant Pseudomonas putida ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A5WBA9

Expression Region

1-289

Origin

Pseudomonas putida (strain F1 / ATCC 700007)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFL LIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLVPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MASP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]
CF812529 100 µg

MASP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

Sign In for Pricing
View Details
Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI3C6]
CF807081 100 µg

Lymphocyte Activation Gene 3 (LAG3) Mouse Monoclonal Antibody [Clone ID: OTI3C6]

Sign In for Pricing
View Details
HB EGF (HBEGF) Mouse Monoclonal Antibody [Clone ID: OTI10A4]
CF812463 100 µg

HB EGF (HBEGF) Mouse Monoclonal Antibody [Clone ID: OTI10A4]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD22 Antibody[Cy34.1]
E-AB-F1021UI-01 25 µg

PE/Cyanine5.5 Anti-Mouse CD22 Antibody[Cy34.1]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD22 Antibody[Cy34.1]
E-AB-F1021UI-02 100 µg

PE/Cyanine5.5 Anti-Mouse CD22 Antibody[Cy34.1]

Sign In for Pricing
View Details
Recombinant Human CD69 Protein (aa 62-199, His Tag)
PKSH031235 50 µg

Recombinant Human CD69 Protein (aa 62-199, His Tag)

Sign In for Pricing
View Details