Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)

This Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C3K1F2

Expression Region

1-289

Origin

Pseudomonas fluorescens (strain SBW25)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAETTASGYIQHHLQNLTFGQLPNGGWGFAHSAAEAKEMGFWAFHLDTLGWSVALGLIFV LIFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLIPVDWIPQLAILITGDAHIPFRAVSTTDPNATLGMALSVFALIIFYSIKVKGIGGFI GELTLHPFGSKNIFVQALLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish syt4 Rabbit Polyclonal Antibody (PE)
orb2573466 200 µL

Zebrafish syt4 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Interleukin 10
547992 200 µL

Interleukin 10

Sign In for Pricing
View Details
KIT Antibody
orb389139-01 20 µg

KIT Antibody

Sign In for Pricing
View Details
KIT Antibody
orb389139-02 100 µg

KIT Antibody

Sign In for Pricing
View Details
KIT Antibody
orb389139-03 100 ug (without BSA and Azide)

KIT Antibody

Sign In for Pricing
View Details
Sqd Antibody
orb807782 2 mg

Sqd Antibody

Sign In for Pricing
View Details