Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)

This Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C3K1F2

Expression Region

1-289

Origin

Pseudomonas fluorescens (strain SBW25)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAETTASGYIQHHLQNLTFGQLPNGGWGFAHSAAEAKEMGFWAFHLDTLGWSVALGLIFV LIFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLIPVDWIPQLAILITGDAHIPFRAVSTTDPNATLGMALSVFALIIFYSIKVKGIGGFI GELTLHPFGSKNIFVQALLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO10 Protein Vector (Mouse) (pPM-C-His)
PV178597 500 ng

FBXO10 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
DO53
orb1697369 25 mg

DO53

Sign In for Pricing
View Details
Magic™ Membrane Protein Human XKRY (XK related, Y-linked) Full Length
MPC4787K Each

Magic™ Membrane Protein Human XKRY (XK related, Y-linked) Full Length

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Prostaglandin E Receptor 2 (EP2)
MBS2040081-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Prostaglandin E Receptor 2 (EP2)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Prostaglandin E Receptor 2 (EP2)
MBS2040081-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Prostaglandin E Receptor 2 (EP2)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Prostaglandin E Receptor 2 (EP2)
MBS2040081-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Prostaglandin E Receptor 2 (EP2)

Sign In for Pricing
View Details