Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)

This Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

C3K1F2

Expression Region

1-289

Origin

Pseudomonas fluorescens (strain SBW25)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAETTASGYIQHHLQNLTFGQLPNGGWGFAHSAAEAKEMGFWAFHLDTLGWSVALGLIFV LIFRMAAKKATSGQPGALQNFVEVLVEFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLIPVDWIPQLAILITGDAHIPFRAVSTTDPNATLGMALSVFALIIFYSIKVKGIGGFI GELTLHPFGSKNIFVQALLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMRN1 Recombinant Protein
OPCD05354-50UG 50 µg

MMRN1 Recombinant Protein

Sign In for Pricing
View Details
HTLV1 gp46 protein
30-043001F 100 ug

HTLV1 gp46 protein

Sign In for Pricing
View Details
C3orf36 HDR Plasmid (h)
sc-413335-HDR 20 µg

C3orf36 HDR Plasmid (h)

Sign In for Pricing
View Details
Stat1 Rat shRNA Lentiviral Particle (Locus ID 25124)
TL711678V 500 µL Each

Stat1 Rat shRNA Lentiviral Particle (Locus ID 25124)

Sign In for Pricing
View Details
Dusp22 3'UTR Luciferase Stable Cell Line
TU203691 1.0 mL

Dusp22 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
LIPC Recombinant Protein
OPCD04965-10UG 10 µg

LIPC Recombinant Protein

Sign In for Pricing
View Details