Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas putida ATP synthase subunit a (atpB)

This Recombinant Pseudomonas putida ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B1JFU7

Expression Region

1-289

Origin

Pseudomonas putida (strain W619)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAETASGYIQHHLQNLTYGQLPDGSWGFAHSAAEAKAMGFWAFHLDTLGWSVALGLIFL FIFRMAAKKATSGQPGGLQNFVEVMVDFVNGSVKDSFHGRSPVIAPLALTIFVWVFLMNA VDLVPVDWIPQLAILISGDPHIPFRAVSTTDPNATLAMAFCVFALIIFYSIKVKGLGGFI GELTLHPFGSKNIFVQILLIPVNFLLEFVTLIAKPISLALRLFGNMYAGELVFILIAVMF GSGLLWLSGLGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEDNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDCD2 Antibody
ABD9028 100 µg

PDCD2 Antibody

Sign In for Pricing
View Details
Hemopexin ELISA Kit (Rat) (OKIA00149)
OKIA00149 96 Well

Hemopexin ELISA Kit (Rat) (OKIA00149)

Sign In for Pricing
View Details
Goat Adenylate cyclase type 5 (ADCY5) ELISA kit
GTR10437318 96 Well

Goat Adenylate cyclase type 5 (ADCY5) ELISA kit

Sign In for Pricing
View Details
ERK1 (MAPK3) (NM_002746) Human Recombinant Protein
E45H39942M5 20 µg

ERK1 (MAPK3) (NM_002746) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Deinococcus deserti Glucose-1-phosphate adenylyltransferase (glgC)
MBS1187286-01 0.02 mg (E-Coli)

Recombinant Deinococcus deserti Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details
Recombinant Deinococcus deserti Glucose-1-phosphate adenylyltransferase (glgC)
MBS1187286-02 0.02 mg (Yeast)

Recombinant Deinococcus deserti Glucose-1-phosphate adenylyltransferase (glgC)

Sign In for Pricing
View Details