Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, sodium ion specific (atpB)

This Recombinant ATP synthase subunit a, sodium ion specific (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, sodium ion specific, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P21903

Expression Region

1-289

Origin

Propionigenium modestum

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKMGPIILAVVIAIGTFALKMMGVIGFKTPPLVEGPKIMFYVPLPEAMHDFPFAMEMAS GVYGFPVTITVISTWFVMLFLIMVFRWSSKNLEVVPERKQAFFETIYGFLDDLYGQLLGN WKKKYFTYIGTLFLFLLISNIVSFFPIPGFSSENGVFSIAPALRTPTADLNTTVGLALLT TYSFIAASFRTSGFFGFFKGLFEPMPLMFPINLAGEFAKPTNISIRLFGNMFAGMVILGL LYKAAPVLIPAPLHLYFDLFSGVVQSFVFIMLTMVYIQGSIGDAEYLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CASQ2 Protein, His, E.coli-1mg
QP11281-1mg 1mg

Recombinant Human CASQ2 Protein, His, E.coli-1mg

Sign In for Pricing
View Details
RAD9B Protein Vector (Human) (pPB-N-His)
PV034226 500 ng

RAD9B Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rat Nrn1 Pre-designed siRNA Set B
SI209549B 1 Each

Rat Nrn1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-SARS-CoV-2 Spike Protein Mouse IgA ELISA Kit
VK474018 96 Tests

Anti-SARS-CoV-2 Spike Protein Mouse IgA ELISA Kit

Sign In for Pricing
View Details
RPL35AP25 sgRNA CRISPR Lentivector (Human) (Target 3)
K1976404 1.0 µg DNA

RPL35AP25 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cotl1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4547804 1.0 µg DNA

Cotl1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details