Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant ATP synthase subunit a, sodium ion specific (atpB)

This Recombinant ATP synthase subunit a, sodium ion specific (atpB) spans the amino acid sequence from region 1-289.

Product Specifications

Product Name Alternative

ATP synthase subunit a, sodium ion specific, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

P21903

Expression Region

1-289

Origin

Propionigenium modestum

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKMGPIILAVVIAIGTFALKMMGVIGFKTPPLVEGPKIMFYVPLPEAMHDFPFAMEMAS GVYGFPVTITVISTWFVMLFLIMVFRWSSKNLEVVPERKQAFFETIYGFLDDLYGQLLGN WKKKYFTYIGTLFLFLLISNIVSFFPIPGFSSENGVFSIAPALRTPTADLNTTVGLALLT TYSFIAASFRTSGFFGFFKGLFEPMPLMFPINLAGEFAKPTNISIRLFGNMFAGMVILGL LYKAAPVLIPAPLHLYFDLFSGVVQSFVFIMLTMVYIQGSIGDAEYLED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal WDR57 Antibody
NBP3-15611-20ul 20 µL

Rabbit Polyclonal WDR57 Antibody

Sign In for Pricing
View Details
TEC Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-15505R-BF594 100 µL

TEC Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712907 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Tri-o-tolyl-Phosphine Oxide
TRC-T765600-250MG 250 mg

Tri-o-tolyl-Phosphine Oxide

Sign In for Pricing
View Details
Rabbit Polyclonal UHRF1BP1L Antibody [Alexa Fluor 405]
NBP2-82047AF405 0.1 mL

Rabbit Polyclonal UHRF1BP1L Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
ASB3 sgRNA CRISPR Lentivector set (Human)
K0131301 3x 1.0 µg

ASB3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details