Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guillardia theta Uncharacterized tatC-like protein ycf43 (ycf43)

This Recombinant Guillardia theta Uncharacterized tatC-like protein ycf43 (ycf43) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Uncharacterized tatC-like protein ycf43

UniProt

O78493

Expression Region

1-290

Origin

Guillardia theta (Cryptomonas phi)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLFNLTVLVMKTFKFHYKFILLFSNKFRFYLYYYMKTRSNSVLIPYTLNFKQVEAEMSLA EHLEEIRQRAFWSFSVLTTMIISCIIFVKNIVKTLQEPAAGIKFLQFAPGEYFFASIKVA AYSGILISSPFIVYQILLFVLPGMTKDERKTLLPIIIGSMILFLLGLIFGYYILVPASLN FFIKYGSDVVEPFWSFEQYFEFILVLLFGTALAFQLPVLQLVLGFLRIVSGKTMFSIWRY VILLSTVVGAVLTPSVDPLTQILLSSIILILYFGGASLVLVVEGSQKNNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-100 1x 100 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
BNC680029-100 1x 100 µL

Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL
BNC040270-100 1x 100 µL

Fibronectin (HFN7.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF647 conjugate, 0.1mg/mL
BNC470039-100 1x 100 µL

CD34 (ICO-115), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF405S conjugate, 0.1mg/mL
BNC042167-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details