Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Sodalis glossinidius 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

Q2NR07

Expression Region

1-290

Origin

Sodalis glossinidius (strain morsitans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDHSLTQDRWQAWCRLMRIDKPIGSLLLLWPTLWALWLAGMAIPALGTLTVFILGVFFMR AAGCVINDYADRKIDGHVKRTRARPLPSGAIGEKEAKLLFGALVGISFALVLTLNSMTIA LSTVALALAWVYPFMKRYTHLPQLVLGAAFGWSIPMVFTAVSESLPLSCWLLFLANITWT VAYDTQYAMVDRDDDLRIGVKSTAILFGRFDKLIIGLLQLATLLLLGVIGWQLGLGRIYY LALAGAAGLFLWQQKLIVDREREACFRAFLNNNLVGMLIFVGILLSLLSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL
BNC470304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF594 conjugate, 0.1mg/mL
BNC940828-100 1x 100 µL

CD79a (JCB117 + HM47/A9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/835), CF488A conjugate, 0.1mg/mL
BNC880835-100 1x 100 µL

Cytokeratin 18 (KRT18/835), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (MUC6/916), CF647 conjugate, 0.1mg/mL
BNC470916-100 1x 100 µL

Mucin 6 (MUC6) (MUC6/916), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/798), CF640R conjugate, 0.1mg/mL
BNC400798-500 1x 500 µL

Chromogranin A (CHGA/798), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF568 conjugate, 0.1mg/mL
BNC681986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details