Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)

This Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q4K3A3

Expression Region

1-290

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAETTASGYIQHHLQNLTFGQLPNGSWGFAHSAAEAKEMGFWAFHVDTLGWSVALGVIF ILLFRMAAKKATSGVPGALQNFVEVMVGFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMN AIDLVPVDWIPQLAMLISGDQHIPFRAVSTTDPNATLGMALSVFALIIFYSIKVKGIGGF IGELTLHPFGSKNILVQALLIPVNFLLEFVTLVAKPISLALRLFGNMYAGELVFILIAVM FGSGLLWLSGMGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), 1mg/mL
BNUM1706-50 1x 50 µL

S100B (Astrocyte and Melanoma Marker) (S100B/1706R), 1mg/mL

Sign In for Pricing
View Details
IFI35 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G5]
TA503360BM 100 µL

IFI35 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G5]

Sign In for Pricing
View Details
CSNK1G1 Mouse Monoclonal Antibody [Clone ID: OTI2B5]
CF806332 100 µg

CSNK1G1 Mouse Monoclonal Antibody [Clone ID: OTI2B5]

Sign In for Pricing
View Details
Synaptophysin (Neuroendocrine Marker) (SYP/3551), CF405S conjugate, 0.1mg/mL
BNC043551-500 1x 500 µL

Synaptophysin (Neuroendocrine Marker) (SYP/3551), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD95/Fas Antibody[DX2]
E-AB-F1168M-01 20 Tests

Elab Fluor® 647 Anti-Human CD95/Fas Antibody[DX2]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD95/Fas Antibody[DX2]
E-AB-F1168M-02 100 Tests

Elab Fluor® 647 Anti-Human CD95/Fas Antibody[DX2]

Sign In for Pricing
View Details