Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB)

This Recombinant Pseudomonas fluorescens ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q4K3A3

Expression Region

1-290

Origin

Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSAETTASGYIQHHLQNLTFGQLPNGSWGFAHSAAEAKEMGFWAFHVDTLGWSVALGVIF ILLFRMAAKKATSGVPGALQNFVEVMVGFVDGSVKDSFHGRSPVIAPLALTIFVWVFLMN AIDLVPVDWIPQLAMLISGDQHIPFRAVSTTDPNATLGMALSVFALIIFYSIKVKGIGGF IGELTLHPFGSKNILVQALLIPVNFLLEFVTLVAKPISLALRLFGNMYAGELVFILIAVM FGSGLLWLSGMGVVLQWAWAVFHILIITLQAFIFMMLTIVYLSMAHEENH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malt1 (NM_172833) Mouse Over-expression Lysate
LY724110 100 µg

Malt1 (NM_172833) Mouse Over-expression Lysate

Sign In for Pricing
View Details
PRKAR1B Polyclonal Antibody
E-AB-12841-01 20 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR1B Polyclonal Antibody
E-AB-12841-02 60 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR1B Polyclonal Antibody
E-AB-12841-03 120 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR1B Polyclonal Antibody
E-AB-12841-04 200 µL

PRKAR1B Polyclonal Antibody

Sign In for Pricing
View Details
TTF1 (NKX2-1) Human Gene Knockout Kit (CRISPR)
KN202477LP 1 Kit

TTF1 (NKX2-1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details