Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative neuropeptide Y receptor type 6 (NPY6R)

This Recombinant Human Putative neuropeptide Y receptor type 6 (NPY6R) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Putative neuropeptide Y receptor type 6, NPY6-R, NPY Y1-like receptor, Putative pancreatic polypeptide receptor 2, PP2

UniProt

Q99463

Expression Region

1-290

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIII FKKQRKAQNFTSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSI SVSIFSLVFTAVERYQLIVNPRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPF RNLSLPTDLYTHQVACVENWPSKKDRLLFTTSLFLLQYFVPLGFILICYLKIVICLRRRN AKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISSMSSLTGIMRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IFNGR1/CD119 Protein (His Tag)
PKSM040535 100 µg

Recombinant Mouse IFNGR1/CD119 Protein (His Tag)

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), Biotin conjugate, 0.1mg/mL
BNCB2076-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (GFAP/2076), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PPIL5 (LRR1) (NM_203467) Human Over-expression Lysate
LC404280 20 µg

PPIL5 (LRR1) (NM_203467) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF217 (N-term) Rabbit Polyclonal Antibody
AP54677PU-N 400 µL

ZNF217 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
cis-1-Hydroxy-2,7-diamino Mitosene
TRC-H939705-5MG 5 mg

cis-1-Hydroxy-2,7-diamino Mitosene

Sign In for Pricing
View Details
Alpha-Bungarotoxin, CF®543, 100 ug
#00026-100ug 1x 100 µg

Alpha-Bungarotoxin, CF®543, 100 ug

Sign In for Pricing
View Details