Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative neuropeptide Y receptor type 6 (NPY6R)

This Recombinant Human Putative neuropeptide Y receptor type 6 (NPY6R) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Putative neuropeptide Y receptor type 6, NPY6-R, NPY Y1-like receptor, Putative pancreatic polypeptide receptor 2, PP2

UniProt

Q99463

Expression Region

1-290

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVSLNHPASNTTSTKNNNSAFFYFESCQPPSPALLLLCIAYTVVLIVGLFGNLSLIIII FKKQRKAQNFTSILIANLSLSDTLVCVMCIHFTIIYTLMDHWIFGDTMCRLTSYVQSVSI SVSIFSLVFTAVERYQLIVNPRGWKPSVTHAYWGITLIWLFSLLLSIPFFLSYHLTDEPF RNLSLPTDLYTHQVACVENWPSKKDRLLFTTSLFLLQYFVPLGFILICYLKIVICLRRRN AKVDKKKENEGRLNENKRINTMLISIVVTFGACWLPRISSMSSLTGIMRC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon
CS624661 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Phospholipase C gamma 1 (PLCG1) pTyr783 Rabbit Polyclonal Antibody
AP02395PU-S 50 µL

Phospholipase C gamma 1 (PLCG1) pTyr783 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS701081 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human ILDR2 activation kit by CRISPRa
GA117891 1 Kit

Human ILDR2 activation kit by CRISPRa

Sign In for Pricing
View Details
MHC II, Mouse (MK-D6), CF647 conjugate, 0.1mg/mL
BNC472007-500 1x 500 µL

MHC II, Mouse (MK-D6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
beta Catenin (CTNNB1) pSer37 Rabbit Polyclonal Antibody
AP02478PU-S 50 µL

beta Catenin (CTNNB1) pSer37 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details