Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Lipid phosphate phosphatase 2 (LPP2)

This Recombinant Arabidopsis thaliana Lipid phosphate phosphatase 2 (LPP2) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Lipid phosphate phosphatase 2, AtLPP2, EC= 3.1.3.-, Phosphatidic acid phosphatase 2, AtPAP2, Prenyl diphosphate phosphatase

UniProt

Q9XI60

Expression Region

1-290

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPEIHLGAHTIRSHGVTVARFHMHDWLILLLLIVIEIVLNVIEPFHRFVGEDMLTDLRYP LQDNTIPFWAVPLIAVVLPFAVICVYYFIRNDVYDLHHAILGLLFSVLITGVITDAIKDA VGRPRPDFFWRCFPDGIGIFHNVTKNVLCTGAKDVVKEGHKSFPSGHTSWSFAGLGFLSL YLSGKIRVFDQRGHVAKLCIVILPLLVAALVGVSRVDDYWHHWQDVFGGAIIGLTVATFC YLQFFPPPYDPDGWGPHAYFQMLADSRNDVQDSAGMNHLSVRQTELESVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-100 1x 100 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
BNC680225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2952), CF640R conjugate, 0.1mg/mL
BNC402952-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2952), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF640R conjugate, 0.1mg/mL
BNC402000-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (rKRT8.18/1346), CF640R conjugate, 0.1mg/mL
BNC402298-100 1x 100 µL

Cytokeratin 8/18 (rKRT8.18/1346), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details