Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD)

This Recombinant Pseudomonas aeruginosa Type 4 prepilin-like proteins leader peptide-processing enzyme (pilD) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Protein pilD, Protein secretion protein XCPA, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Alternative name

UniProt

P22610

Expression Region

1-290

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPLLDYLASHPLAFVLCTILLGLLVGSFLNVVVHRLPKMMERNWKAEAREALGLEPEPKQ ATYNLVLPNSACPRCGHEIRPWENIPLVSYLALGGKCSSCKAAIGKRYPLVELATALLSG YVAWHFGFTWQAGAMLLLTWGLLAMSLIDADHQLLPDVLVLPLLWLGLIANHFGLFASLD DALFGAVFGYLSLWSVFWLFKLVTGKEGMGYGDFKLLAMLGAWGGWQILPLTILLSSLVG AILGVIMLRLRNAESGTPIPFGPYLAIAGWIALLWGDQITRTYLQFAGFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-AMPKα1-T183+AMPKα2-T172 Rabbit mAb
AP1441-01 20 µL

Phospho-AMPKα1-T183+AMPKα2-T172 Rabbit mAb

Sign In for Pricing
View Details
Phospho-AMPKα1-T183+AMPKα2-T172 Rabbit mAb
AP1441-02 100 μL

Phospho-AMPKα1-T183+AMPKα2-T172 Rabbit mAb

Sign In for Pricing
View Details
Phospho-AMPKα1-T183+AMPKα2-T172 Rabbit mAb
AP1441-03 500 μL

Phospho-AMPKα1-T183+AMPKα2-T172 Rabbit mAb

Sign In for Pricing
View Details
Phospho-AMPKα1-T183+AMPKα2-T172 Rabbit mAb
AP1441-04 1000 μL

Phospho-AMPKα1-T183+AMPKα2-T172 Rabbit mAb

Sign In for Pricing
View Details
Rat Teratocarcinoma Derived Growth Factor 1 ELISA Kit
MBS031486-01 48 Well

Rat Teratocarcinoma Derived Growth Factor 1 ELISA Kit

Sign In for Pricing
View Details
Rat Teratocarcinoma Derived Growth Factor 1 ELISA Kit
MBS031486-02 96 Well

Rat Teratocarcinoma Derived Growth Factor 1 ELISA Kit

Sign In for Pricing
View Details