Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative transport permease ycf38 (ycf38)

This Recombinant Putative transport permease ycf38 (ycf38) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Putative transport permease ycf38, ORF291

UniProt

P51321

Expression Region

1-291

Origin

Porphyra purpurea

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFAFSKKIELKPILKFDTPKVYSYEIIQEIEALVQRLFLQVWRRPATLMAGIIQPLLWL VLFGGLFCNAPVNLFTINTSYNRFLSSGIIVFTSFTGALNSGLPLMFDREFGFLNRLLTA PLISRTSIIFSSATFMTCLSLIQVIFIVIASLFMGNSPLSSNSTLIFALIVLLVTVGVTM LSLALSFTLPGHIELLALILVVNLPFLFSSTALAPLYFMPPWLQLIASLNPLSYAIEGIR YIYSNTDWNFTESVIKISWGDISLGQIISLLLFLDVIGAYIVSNILKARLN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dipsacus saponin XII
HY-N15231-01 1 mg

Dipsacus saponin XII

Sign In for Pricing
View Details
Dipsacus saponin XII
HY-N15231-02 5 mg

Dipsacus saponin XII

Sign In for Pricing
View Details
Dipsacus saponin XII
HY-N15231-03 10 mg

Dipsacus saponin XII

Sign In for Pricing
View Details
Mouse Tendon Fibroblasts
RPC-521 5x 10^5

Mouse Tendon Fibroblasts

Sign In for Pricing
View Details
Nampt Mouse Gene Knockout Kit (CRISPR)
KN510718 1 Kit

Nampt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Canine Chloride Channel Protein 1 ELISA Kit
MBS755192-01 48 Well

Canine Chloride Channel Protein 1 ELISA Kit

Sign In for Pricing
View Details