Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative peptide transport permease protein Mb1313c (Mb1313c)

This Recombinant Putative peptide transport permease protein Mb1313c (Mb1313c) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Putative peptide transport permease protein Mb1313c

UniProt

P66965

Expression Region

1-291

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEFASRRTLVVRRFLRNRAAVASLAALLLLFVSAYALPPLLPYSYDDLDFNALLQPPGT KHWLGTNALGQDLLAQTLRGMQKSMLIGVCVAVISTGIAATVGAISGYFGGWRDRTLMWV VDLLLVVPSFILIAIVTPRTKNSANIMFLVLLLAGFGWMISSRMVRGMTMSLREREFIRA ARYMGVSSRRIIVGHVVPNVASILIIDAALNVAAAILAETGLSFLGFGIQPPDVSLGTLI ADGTASATAFPWVFLFPASILVLILVCANLTGDGLRDALDPASRSLRRGVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-500 1x 500 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF740 conjugate, 0.1mg/mL
BNC741052-500 1x 500 µL

CD3e (B-B12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-100 1x 100 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (JCB117 + HM47/A9), CF488A conjugate, 0.1mg/mL
BNC880828-500 1x 500 µL

CD79a (JCB117 + HM47/A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF740 conjugate, 0.1mg/mL
BNC742302-100 1x 100 µL

MUC18 / CD146 / MCAM (Melanoma Cell Adhesion Molecule) (rMUC18/1130), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details