Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 41B (TMEM41B)

This Recombinant Human Transmembrane protein 41B (TMEM41B) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Transmembrane protein 41B

UniProt

Q5BJD5

Expression Region

1-291

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSI FLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFAT YIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLT EKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP SFVAIKAGTTLYQLTTAGEAVSWNSIFILMILAVLSILPAIFQKKLKQKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAI2 Antibody
8G214-AAT 50 µg

BAI2 Antibody

Sign In for Pricing
View Details
4’-Hydroxy Diclofenac-D4
TRC-H825227-5MG 5 mg

4’-Hydroxy Diclofenac-D4

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: left
CS634471 5x 5 µm

Frozen Tissue Sections, Ovary: left

Sign In for Pricing
View Details
TOX3 (TOX3/1124), CF640R conjugate, 0.1mg/mL
BNC401124-100 1x 100 µL

TOX3 (TOX3/1124), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
H2-Q7 Rabbit Polyclonal Antibody
TA363345 100 µL

H2-Q7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SEC24B (NM_001042734) Human Over-expression Lysate
LY420801 100 µg

SEC24B (NM_001042734) Human Over-expression Lysate

Sign In for Pricing
View Details