Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 41B (TMEM41B)

This Recombinant Human Transmembrane protein 41B (TMEM41B) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Transmembrane protein 41B

UniProt

Q5BJD5

Expression Region

1-291

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSI FLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFAT YIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLT EKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP SFVAIKAGTTLYQLTTAGEAVSWNSIFILMILAVLSILPAIFQKKLKQKFE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOMM40L Mouse Monoclonal Antibody [Clone ID: OTI5B1]
CF810663 100 µg

TOMM40L Mouse Monoclonal Antibody [Clone ID: OTI5B1]

Sign In for Pricing
View Details
Tmem234 Mouse Gene Knockout Kit (CRISPR)
KN517820 1 Kit

Tmem234 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl Valerate
TRC-E289271-1G 1 g

Ethyl Valerate

Sign In for Pricing
View Details
p53 (TP53) Human Gene Knockout Kit (CRISPR)
KN400003 1 Kit

p53 (TP53) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX5 Human Gene Knockout Kit (CRISPR)
KN200371LP 1 Kit

DDX5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Eosinophil Peroxidase (EPO104), CF740 conjugate, 0.1mg/mL
BNC740104-500 1x 500 µL

Eosinophil Peroxidase (EPO104), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details