Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Kidney mitochondrial carrier protein 1 (Slc25a30)

This Recombinant Rat Kidney mitochondrial carrier protein 1 (Slc25a30) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Kidney mitochondrial carrier protein 1, Solute carrier family 25 member 30

UniProt

Q5PQM9

Expression Region

1-291

Origin

Rattus norvegicus (Rat)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFREIRYRGMLHALMRIG REEGLRALYSGIAPAMLRQASYGTIKIGTYQSLKRLAVERPEDETLLINVVCGILSGVIS SAIANPTDVLKIRMQAQNSAVQGGMIGNFISIYQQEGTRGLWKGVSLTAQRAAIVVGVEL PVYDITKKHLILSGLMGDTVSTHFLSSFTCGLVGALASNPVDVVRTRMMNQRDLRDGRCS GYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKLDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF647 conjugate, 0.1mg/mL
BNC470193-500 1x 500 µL

CD86 (BU63), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL
BNC400633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL
BNC940257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-500 1x 500 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF647 conjugate, 0.1mg/mL
BNC470645-100 1x 100 µL

FOXP3 (3G3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL
BNC880978-500 1x 500 µL

CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details