Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Kidney mitochondrial carrier protein 1 (SLC25A30)

This Recombinant Macaca fascicularis Kidney mitochondrial carrier protein 1 (SLC25A30) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Kidney mitochondrial carrier protein 1, Solute carrier family 25 member 30

UniProt

Q8HXE3

Expression Region

1-291

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIG REEGLKALYSGIAPAMLRQSSYGTIKIGTYQSLKRLFVERPEDETLLINVICGILSGVIS STIANPTDVLKIRMQAQSSTIQGGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVEL PVYDITKKHLILSGLMGDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQRVLQDGRCS GYTGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIILFVTYEQLKKLDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL
BNC880151-500 1x 500 µL

CD11a (Cris-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF488A conjugate, 0.1mg/mL
BNC880039-500 1x 500 µL

CD34 (ICO-115), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 3 (M3.1), CF640R conjugate, 0.1mg/mL
BNC400990-500 1x 500 µL

Mucin 3 (M3.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (C1A/711), CF640R conjugate, 0.1mg/mL
BNC400711-100 1x 100 µL

CD1a (C1A/711), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/784), CF640R conjugate, 0.1mg/mL
BNC400784-500 1x 500 µL

CD56 / NCAM (NCAM1/784), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details