Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA)

This Recombinant Brucella melitensis biotype 1 sn-glycerol-3-phosphate transport system permease protein ugpA (ugpA) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Sn-glycerol-3-phosphate transport system permease protein ugpA

UniProt

Q8YCA8

Expression Region

1-291

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQKVTFPNKILPYFLLAPQIVLTVVFFFWPASQAIYQSFMMREDAFGLKSTFVELANFTA VLSDPNYLHSVQVTVVFNVLTALLAMGVALLLATAADRVIRGQTFYRTLLIWPYAVAPAV AGMLWLFMFNPAMGTFAYLLRRNGIAWDPLLDGNQAMGLVVVAAAWKQISYNFLFFVAGL QAIPKSLIEAAAIDGARGARRFWTIVFPLLAPTSFFLLVVNTVYAFFDTFGIIHAVTGGG PAKATETLVYNDGFVNLNLGSSSAQSVILMAIVIALTAFQFRFVEKRVHYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
BNC880460-500 1x 500 µL

CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF640R conjugate, 0.1mg/mL
BNC400449-500 1x 500 µL

CD104 (UM-A9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF740 conjugate, 0.1mg/mL
BNC740342-500 1x 500 µL

CD43 (84-3C1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UPK3A (Uroplakin 3A) (Rabbit PAb), CF594 conjugate, 0.1mg/mL
BNC940409-100 1x 100 µL

UPK3A (Uroplakin 3A) (Rabbit PAb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF568 conjugate, 0.1mg/mL
BNC682563-100 1x 100 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details