Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU08_0540 (ECU08_0540)

This Recombinant Encephalitozoon cuniculi Uncharacterized membrane protein ECU08_0540 (ECU08_0540) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ECU08_0540

UniProt

Q8SUS0

Expression Region

1-291

Origin

Encephalitozoon cuniculi (strain GB-M1) (Microsporidian parasite)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKMDKLAKFEKFDLFFAAIACICGILKVMEMGKEGYPTLGTVSKNGMAVLAVLVALGFL LKYADQMCRRITSHSFSEKGGFLNPCVILSVIEFFMMLICIKAMLFYPAEIPGVDDSSQM EPPISSKFGLFGAIFMPYIFAECIRLLLANKNSRRDRVILGILVLGCLAMAGLAYLEYKG KGNFISAGILGVGLSMLLSRLALVDEDEEDTLLDDSAEGGNVWMYLAMFASFTLVLILLA RSHRILFDNLSFLDSLKSFTFLGRKVSQMASEDPPKDPLPRQEGGGGDTIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF555 conjugate, 0.1mg/mL
BNC550645-100 1x 100 µL

FOXP3 (3G3), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-100 1x 100 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-500 1x 500 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-100 1x 100 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details