Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptomyces coelicolor Undecaprenyl-diphosphatase 2 (uppP2)

This Recombinant Streptomyces coelicolor Undecaprenyl-diphosphatase 2 (uppP2) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase 2, EC= 3.6.1.27, Bacitracin resistance protein 2, Undecaprenyl pyrophosphate phosphatase 2

UniProt

Q9K407

Expression Region

1-291

Origin

Streptomyces coelicolor (strain ATCC BAA-471 / A3 (2) / M145)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWFESLVLGLVQGLTEFLPVSSSAHLRLTAAFSGWHDPGAAFTAITQIGTEAAVLIYFR KDIGRIIAAWTRSLTDKSMRHDPDARMGWLVIVGSIPIGVLGLTLKDQIEGPFRDLRITA TMLIVVGVIIGIADRMAARDEKGGRHRAPQQRKELENLGVRDGLIYGLCQAAALIPGVSR SGATISGGLFMGYRREAAARYSFLLAIPAVLASGVFELKDAMESDHVSWGPTLFATVIAF ATGYVVIAWFMKFISTKSFMPFVWYRIALGIVIIVLVSVGVLSPHAAESGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-500 1x 500 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF594 conjugate, 0.1mg/mL
BNC940333-100 1x 100 µL

CD8 (RIV11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), CF568 conjugate, 0.1mg/mL
BNC681205-500 1x 500 µL

Nucleolin (364-5 + NCL/902), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details