Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Psychromonas ingrahamii UPF0761 membrane protein Ping_3482 (Ping_3482)

This Recombinant Psychromonas ingrahamii UPF0761 membrane protein Ping_3482 (Ping_3482) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

UPF0761 membrane protein Ping_3482

UniProt

A1T0A0

Expression Region

1-292

Origin

Psychromonas ingrahamii (strain 37)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKFGRKIVMDKVKVTYQYLLFVWRRSEQDNIKVPAGHLAYVTLLSIVPLLAVIFYMLAAF PVFSDLKGMLEDLIYNNLLPTSGDTIQEHISGFIENTKKMSMMGIGSLIAIALLLISTID QTINRIWRCTNKRSRIQSFTIYWTILSLGPVIIGASLALSSYLFSVFQEHGSLSFGQRLL SLMPFILTWLTFAGVYTLVPHQRVSFRYALIGGLIAAILFFFGTDLFRLYITNFPSQQII YGALAVIPILFVWIYYSWLIVLIGAEVTATLEEFLKQQEDNNVTKEYLGADI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL
BNC040009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL
BNC940679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL
BNC040158-500 1x 500 µL

Cytokeratin 17 (E3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF647 conjugate, 0.1mg/mL
BNC472474-500 1x 500 µL

CD103 / Integrin alpha E (T-Cell Lymphoma & Hairy Cell Leukemia Marker) (ITGAE/2474), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details