Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fat storage-inducing transmembrane protein 1 (FITM1)

This Recombinant Human Fat storage-inducing transmembrane protein 1 (FITM1) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 1, Fat-inducing protein 1

UniProt

A5D6W6

Expression Region

1-292

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWL AAVVIFGPLLQFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAV TARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRG YTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTV IYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MiTF (Microphthalmia Transcription Factor) (MITF/915), CF594 conjugate, 0.1mg/mL
BNC940915-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (MITF/915), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD55 Human Gene Knockout Kit (CRISPR)
KN401615 1 Kit

CD55 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C11orf96 (NM_001145033) Human Over-expression Lysate
LC428656 20 µg

C11orf96 (NM_001145033) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccz1 Mouse Gene Knockout Kit (CRISPR)
KN502858 1 Kit

Ccz1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF568 conjugate, 0.1mg/mL
BNC682097-500 1x 500 µL

Human IgD (Immunoglobulin Delta Heavy Chain) (B-Cell Marker) (IgD26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Unconjugated Rabbit Anti-GS-I Antibody
AL-2401-2 2 mL

Unconjugated Rabbit Anti-GS-I Antibody

Sign In for Pricing
View Details