Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fat storage-inducing transmembrane protein 1 (Fitm1)

This Recombinant Mouse Fat storage-inducing transmembrane protein 1 (Fitm1) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 1, Fat-inducing protein 1

UniProt

Q91V79

Expression Region

1-292

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERGPTVGAGLGAGTRVRALLGCLVKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWL AAVVIFGPLLQFHVNSRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAV TARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRKSCLAAGHQWRG YTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTV IYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGIPGHGLFPRSRSMRKHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Factor XII (F12) Mouse Monoclonal Antibody [Clone ID: OTI2D12]
CF807225 100 µg

Factor XII (F12) Mouse Monoclonal Antibody [Clone ID: OTI2D12]

Sign In for Pricing
View Details
Human IL-1 beta Recombinant Rabbit monoclonal Antibody
HA750745 100 µL

Human IL-1 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MEK1 (MAP2K1) pSer222 Rabbit Polyclonal Antibody
AP20957PU-N 100 µg

MEK1 (MAP2K1) pSer222 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-01 50 μL

CTAG1A Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-02 100 µL

CTAG1A Antibody

Sign In for Pricing
View Details
CTAG1A Antibody
KC-3790-03 1 mL

CTAG1A Antibody

Sign In for Pricing
View Details