Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Fat storage-inducing transmembrane protein 1 (Fitm1)

This Recombinant Mouse Fat storage-inducing transmembrane protein 1 (Fitm1) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Fat storage-inducing transmembrane protein 1, Fat-inducing protein 1

UniProt

Q91V79

Expression Region

1-292

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERGPTVGAGLGAGTRVRALLGCLVKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWL AAVVIFGPLLQFHVNSRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAV TARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRKSCLAAGHQWRG YTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTV IYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGIPGHGLFPRSRSMRKHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS506009 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL
BNC400178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
5-[4-[[3-Chloro-4-[(3-fluorobenzyl)oxy]phenyl]amino]quinazolin-6-yl]furan-2-carboxylic Acid
TRC-C573340-500MG 500 mg

5-[4-[[3-Chloro-4-[(3-fluorobenzyl)oxy]phenyl]amino]quinazolin-6-yl]furan-2-carboxylic Acid

Sign In for Pricing
View Details
Recombinant Ctsb Antibody
RC-6369-01 50 μL

Recombinant Ctsb Antibody

Sign In for Pricing
View Details
Recombinant Ctsb Antibody
RC-6369-02 100 µL

Recombinant Ctsb Antibody

Sign In for Pricing
View Details
Recombinant Ctsb Antibody
RC-6369-03 1 mL

Recombinant Ctsb Antibody

Sign In for Pricing
View Details