Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Aquaporin-3 (AQP3)

This Recombinant Human Aquaporin-3 (AQP3) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Aquaporin-3, AQP-3, Aquaglyceroporin-3

UniProt

Q92482

Expression Region

1-292

Origin

Homo sapiens (Human)

Field of Research

Kidney & Urological Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTIN LAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVF GLYYDAIWHFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVD PYNNPVPRGLEAFTVGLVVLVIGTSMGFNSGYAVNPARDFGPRLFTALAGWGSAVFTTGQ HWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEENVKLAHVKHKEQI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-100 1x 100 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-100 1x 100 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL
BNC400826-100 1x 100 µL

Ep-CAM / CD326 (EGP40/826), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF594 conjugate, 0.1mg/mL
BNC941035-500 1x 500 µL

CD8 (C8/1035), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL
BNC042289-500 1x 500 µL

Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details